PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00027034-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 264aa    MW: 30003.5 Da    PI: 4.6738
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00027034-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-163373547
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        ++ E++  +++++qlG++ W++Ia++++ gRt++++k++w+++
  WALNUT_00027034-RA 33 SEYEEQMVIELHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 73
                        6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-211084IPR009057Homeodomain-like
PROSITE profilePS500904.171023IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.5E-51022IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-252379IPR009057Homeodomain-like
PROSITE profilePS5129426.6882478IPR017930Myb domain
SMARTSM007171.3E-142876IPR001005SANT/Myb domain
PfamPF002492.0E-143373IPR001005SANT/Myb domain
CDDcd001671.56E-113674No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MVGLTAGLLR CGKSCRLRWT NYLRPDLKRG LLSEYEEQMV IELHAQLGNR WSKIASHLPG  60
RTDNEIKNHW NTHIKKKLKK MGIDPITHRP ISTANDKSQQ EQEQKQKQIP SLTDSDTTPD  120
FDQNKEPETS LEYSSSITEA REEGGKSMTS TCDPMELMNN SFCTDEVPLM EPHEILVACA  180
DSSLSSSSSS SSSSSSNSSN FLQDLQFPDF EWPCDYMSNS MGLWDYDLSR WDLLINDNGD  240
KKQIVDPSLH CPIMVLDQES WAYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-21107840108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707891e-66AB970789.1 Populus nigra PniMYB152 mRNA for MYB transcriptional factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032972.11e-105Myb domain protein 20
TrEMBLA0A061EGV91e-105A0A061EGV9_THECC; Myb domain protein 20
STRINGGLYMA11G33620.14e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.16e-64myb domain protein 43